Recombinant Human CCL15/MIP-5/HCC-2 Protein

Catalog Number: ABB-RP01966
Article Name: Recombinant Human CCL15/MIP-5/HCC-2 Protein
Biozol Catalog Number: ABB-RP01966
Supplier Catalog Number: RP01966
Alternative Catalog Number: ABB-RP01966-20UG,ABB-RP01966-50UG,ABB-RP01966-500UG,ABB-RP01966-1000UG,ABB-RP01966-10UG,ABB-RP01966-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ser46-Ile113
Alternative Names: CCL15, MIP5, NCC3, SCYA15,C-C motif chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage inflammatory protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible cytokine A15, Cleaved into: CCL15(22-92), CCL15(25-92), CCL15(29-92)
Chemokine ligand 15 (CCL15), also known as leukotactin-1, MIP5, MIP1 and HCC-2, is a small cytokine belonging to the C-C chemokine family. CCL15 is prevantly expressed in liver, small intestine, colon, and in certain leukocytes and macrophages of the lung. It is chemotactic for neutrophils, monocytes, and lymphocytes and elicits its effects by binding to cell surface chemokine receptors like CCR1 and CCR3.
Concentration: < 0.01 EU/µg of the protein by LAL method
Molecular Weight: 8.2 KDa
NCBI: 6359
UniProt: Q16663
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Sequence: SFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Target: CCL15, MIP5, NCC3, SCYA15
Application Dilute: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors