Recombinant Human Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein

Artikelnummer: ABB-RP02008
Artikelname: Recombinant Human Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein
Artikelnummer: ABB-RP02008
Hersteller Artikelnummer: RP02008
Alternativnummer: ABB-RP02008-10UG,ABB-RP02008-100UG,ABB-RP02008-20UG,ABB-RP02008-50UG,ABB-RP02008-500UG,ABB-RP02008-1000UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Lys275-Phe496
Alternative Synonym: AGPT2, ANG2,ANGPT2,ANG2
Angiopoietin-2 (Ang-2, also ANGPT2) is a secreted glycoprotein that plays a complex role in angiogenesis and inflammation . Mature Ang-2 is 478 amino acids in length.Ang2 is widely expressed during development, but it is restricted postnatally to highly angiogenic tissues such as the placenta, ovaries, and uterus. It is particularly abundant in vascular endothelial cells (EC) where it is stored in intracellular Weibel Palade bodies.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 26.30 kDa
NCBI: 285
UniProt: O15123
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 20mM MOPS 150 mM NaCl 0.05% CHAPS pH 7.0.
Sequenz: KEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Target-Kategorie: Angiopoietin-2/ANGPT2
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 20mM MOPS 150 mM NaCl 0.05% CHAPS pH 7.0.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Growth Factor,Biosimilar Drug Targets