Recombinant Human Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein

Catalog Number: ABB-RP02008
Article Name: Recombinant Human Angiopoietin-2/ANG-2/ANGPT2(275-496) Protein
Biozol Catalog Number: ABB-RP02008
Supplier Catalog Number: RP02008
Alternative Catalog Number: ABB-RP02008-10UG,ABB-RP02008-100UG,ABB-RP02008-20UG,ABB-RP02008-50UG,ABB-RP02008-500UG,ABB-RP02008-1000UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Lys275-Phe496
Alternative Names: AGPT2, ANG2,ANGPT2,ANG2
Angiopoietin-2 (Ang-2, also ANGPT2) is a secreted glycoprotein that plays a complex role in angiogenesis and inflammation . Mature Ang-2 is 478 amino acids in length.Ang2 is widely expressed during development, but it is restricted postnatally to highly angiogenic tissues such as the placenta, ovaries, and uterus. It is particularly abundant in vascular endothelial cells (EC) where it is stored in intracellular Weibel Palade bodies.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 26.30 kDa
NCBI: 285
UniProt: O15123
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 20mM MOPS 150 mM NaCl 0.05% CHAPS pH 7.0.
Sequence: KEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Target: Angiopoietin-2/ANGPT2
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 20mM MOPS 150 mM NaCl 0.05% CHAPS pH 7.0.
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Growth Factor,Biosimilar Drug Targets