Recombinant Cynomolgus TNFRSF17/BCMA/CD269 Protein, Human

Produktübersicht

• Artikelname: Recombinant Cynomolgus TNFRSF17/BCMA/CD269 Protein, Human
• Artikelnummer: ABB-RP02009
• Hersteller Artikelnummer: RP02009
• Alternativnummer: ABB-RP02009-500UG,ABB-RP02009-100UG,ABB-RP02009-1000UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Monkey
• Immunogen: Met1-Ala53
• Alternative Synonym: BCMA,TNFRSF17

Produktbeschreibung

B-cell maturation antigen (BCMA or BCM), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17), is a protein that in humans is encoded by the TNFRSF17 gene.TNFRSF17 is a cell surface receptor of the TNF receptor superfamily which recognizes B-cell activating factor (BAFF).

Produkteigenschaften

• Konzentration: < 0.1 EU/µg of the protein by LAL method.
• Molekulargewicht: 31.5 kDa
• NCBI: 102145399
• UniProt: G7Q0I4
• Reinheit: 95 % as determined by SDS-PAGE,95 % as determined by HPLC.
• Formulierung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
• Sequenz: MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNA
• Target-Kategorie: Cynomolgus TNFRSF17/BCMA/CD269

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: CAR-T Cell Therapy Targets,TNF family