Recombinant Cynomolgus TNFRSF17/BCMA/CD269 Protein, Human

Product Overview

• Article Name: Recombinant Cynomolgus TNFRSF17/BCMA/CD269 Protein, Human
• Biozol Catalog Number: ABB-RP02009
• Supplier Catalog Number: RP02009
• Alternative Catalog Number: ABB-RP02009-500UG,ABB-RP02009-100UG,ABB-RP02009-1000UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Monkey
• Immunogen: Met1-Ala53
• Alternative Names: BCMA,TNFRSF17

Product Description

B-cell maturation antigen (BCMA or BCM), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17), is a protein that in humans is encoded by the TNFRSF17 gene.TNFRSF17 is a cell surface receptor of the TNF receptor superfamily which recognizes B-cell activating factor (BAFF).

Product Properties

• Concentration: < 0.1 EU/µg of the protein by LAL method.
• Molecular Weight: 31.5 kDa
• NCBI: 102145399
• UniProt: G7Q0I4
• Purity: 95 % as determined by SDS-PAGE,95 % as determined by HPLC.
• Form: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
• Sequence: MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNA
• Target: Cynomolgus TNFRSF17/BCMA/CD269

Application Notes

• Application Dilute: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
• Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: CAR-T Cell Therapy Targets,TNF family