Recombinant Human DLL3 Protein

Artikelnummer: ABB-RP02041
Artikelname: Recombinant Human DLL3 Protein
Artikelnummer: ABB-RP02041
Hersteller Artikelnummer: RP02041
Alternativnummer: ABB-RP02041-500UG,ABB-RP02041-1000UG,ABB-RP02041-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ala27-Arg490
Alternative Synonym: Delta-like protein 3, SCDO1, DLL3
Delta-like 3 (Drosophila), also known as DLL3, is a protein which in humans is encoded by the DLL3 gene.Two transcript variants encoding distinct isoforms have been identified for this gene.Mutations in this gene cause the autosomal recessive genetic disorder Jarcho-Levin syndrome.Expression of the gene occurs in Neuroendocrine tumors, which has been targeted as a potential pathway for treatment.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 50.4 kDa
NCBI: 10683
UniProt: Q9NYJ7
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, 200 mM Arginine, pH 7.4. Contact us for customized product form or formulation.
Sequenz: AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGN
Target-Kategorie: DLL3
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, 200 mM Arginine, pH 7.4. Contact us for customized product form or formulation.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Biosimilar Drug Targets