Recombinant Human DLL3 Protein

Catalog Number: ABB-RP02041
Article Name: Recombinant Human DLL3 Protein
Biozol Catalog Number: ABB-RP02041
Supplier Catalog Number: RP02041
Alternative Catalog Number: ABB-RP02041-500UG,ABB-RP02041-1000UG,ABB-RP02041-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ala27-Arg490
Alternative Names: Delta-like protein 3, SCDO1, DLL3
Delta-like 3 (Drosophila), also known as DLL3, is a protein which in humans is encoded by the DLL3 gene.Two transcript variants encoding distinct isoforms have been identified for this gene.Mutations in this gene cause the autosomal recessive genetic disorder Jarcho-Levin syndrome.Expression of the gene occurs in Neuroendocrine tumors, which has been targeted as a potential pathway for treatment.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 50.4 kDa
NCBI: 10683
UniProt: Q9NYJ7
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, 200 mM Arginine, pH 7.4. Contact us for customized product form or formulation.
Sequence: AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGN
Target: DLL3
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, 200 mM Arginine, pH 7.4. Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Biosimilar Drug Targets