Recombinant Human Leukemia inhibitory factor receptor/LIF-R/CD118 Protein

Produktübersicht

• Artikelname: Recombinant Human Leukemia inhibitory factor receptor/LIF-R/CD118 Protein
• Artikelnummer: ABB-RP02434
• Hersteller Artikelnummer: RP02434
• Alternativnummer: ABB-RP02434-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Gln45-Ser833
• Alternative Synonym: LIFR,CD118,LIF-R,SJS2,STWS,SWS

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 116.1 kDa
• NCBI: 3977
• UniProt: P42702
• Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequenz: QKKGAPHDLKCVTNNLQVWNCSWKAPSGTGRGTDYEVCIENRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGSSTSKFTLNEQNVSLIPDTPEILNLSADFSTSTLYLKWNDRGSVFPHRSNVIWEIKVLRKESMELVKLVTHNTTLNGKDTLHHWSWASDMPLECAIHFVEIRCYIDNLHFSGLEEWSDWSPVKNISWIPDSQTKVFPQDKVILVGSDITFCCVSQEKVLSALIGHTNCPLIHLDGENVAI
• Target-Kategorie: Leukemia inhibitory factor receptor/LIF-R/CD118

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Bio-Markers & CD Antigens