Recombinant Human Leukemia inhibitory factor receptor/LIF-R/CD118 Protein

Product Overview

• Article Name: Recombinant Human Leukemia inhibitory factor receptor/LIF-R/CD118 Protein
• Biozol Catalog Number: ABB-RP02434
• Supplier Catalog Number: RP02434
• Alternative Catalog Number: ABB-RP02434-500UG,ABB-RP02434-100UG,ABB-RP02434-1000UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Gln45-Ser833
• Alternative Names: LIFR,CD118,LIF-R,SJS2,STWS,SWS

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 116.1 kDa
• NCBI: 3977
• UniProt: P42702
• Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequence: QKKGAPHDLKCVTNNLQVWNCSWKAPSGTGRGTDYEVCIENRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGSSTSKFTLNEQNVSLIPDTPEILNLSADFSTSTLYLKWNDRGSVFPHRSNVIWEIKVLRKESMELVKLVTHNTTLNGKDTLHHWSWASDMPLECAIHFVEIRCYIDNLHFSGLEEWSDWSPVKNISWIPDSQTKVFPQDKVILVGSDITFCCVSQEKVLSALIGHTNCPLIHLDGENVAI
• Target: Leukemia inhibitory factor receptor/LIF-R/CD118

Application Notes

• Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Bio-Markers & CD Antigens