Biotinylated Recombinant SARS-CoV Spike S1 Protein, Human

Produktübersicht

• Artikelname: Biotinylated Recombinant SARS-CoV Spike S1 Protein, Human
• Artikelnummer: ABB-RP02485
• Hersteller Artikelnummer: RP02485
• Alternativnummer: ABB-RP02485-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Virus
• Immunogen: Ser14-Arg667
• Alternative Synonym: Spike, Spike RBD, Spike S1, sars-cov

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 100.6 kDa
• NCBI: 1489668
• UniProt: P59594
• Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequenz: SDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSPAQDIWGTSAAAYFVGYLKPTTFMLKYDE
• Target-Kategorie: SARS-CoV Spike S1

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Coronavirus antigens