Biotinylated Recombinant SARS-CoV Spike S1 Protein, Human

Product Overview

• Article Name: Biotinylated Recombinant SARS-CoV Spike S1 Protein, Human
• Biozol Catalog Number: ABB-RP02485
• Supplier Catalog Number: RP02485
• Alternative Catalog Number: ABB-RP02485-100UG,ABB-RP02485-500UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Virus
• Immunogen: Ser14-Arg667
• Alternative Names: Spike, Spike RBD, Spike S1, sars-cov

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 100.6 kDa
• NCBI: 1489668
• UniProt: P59594
• Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequence: SDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSPAQDIWGTSAAAYFVGYLKPTTFMLKYDE
• Target: SARS-CoV Spike S1

Application Notes

• Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Coronavirus antigens