Recombinant Mouse IL-1 alpha Protein, E. coli

Produktübersicht

• Artikelname: Recombinant Mouse IL-1 alpha Protein, E. coli
• Artikelnummer: ABB-RP02518
• Hersteller Artikelnummer: RP02518
• Alternativnummer: ABB-RP02518-20UG,ABB-RP02518-50UG,ABB-RP02518-500UG,ABB-RP02518-1000UG,ABB-RP02518-10UG,ABB-RP02518-100UG
• Hersteller: ABclonal
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Mouse
• Immunogen: Ser115-Ser270
• Alternative Synonym: Il1a , Interleukin-1 alpha, IL-1 alpha

Produktbeschreibung

Interleukin 1 alpha (IL-1alpha) also known as hematopoietin 1 is a cytokine of the interleukin 1 family that in humans is encoded by the IL1A gene. IL-1alpha is produced mainly by activated macrophages, as well as neutrophils, epithelial cells, and endothelial cells. It possesses metabolic, physiological, haematopoietic activities, and plays one of the central roles in the regulation of the immune responses. It binds to the interleukin-1 receptor. It is on the pathway that activates tumor necrosis factor-alpha.

Produkteigenschaften

• Konzentration: < 0.1 EU/µg of the protein by LAL method.
• Molekulargewicht: 17.99 kDa
• Tag: C-His
• NCBI: 16175
• UniProt: P01582
• Quelle: E. coli
• Reinheit: 95 % as determined by SDS-PAGE, 95 % as determined by HPLC.
• Formulierung: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
• Sequenz: SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
• Target-Kategorie: Il1a

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
• Anwendungsbeschreibung: Cross-Reactivity: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water., ResearchArea: Other Recombinant Protein