Recombinant Mouse IL-1 alpha Protein, E. coli

Product Overview

• Article Name: Recombinant Mouse IL-1 alpha Protein, E. coli
• Biozol Catalog Number: ABB-RP02518
• Supplier Catalog Number: RP02518
• Alternative Catalog Number: ABB-RP02518-20UG,ABB-RP02518-50UG,ABB-RP02518-500UG,ABB-RP02518-1000UG,ABB-RP02518-10UG,ABB-RP02518-100UG
• Manufacturer: ABclonal
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Immunogen: Ser115-Ser270
• Alternative Names: Il1a , Interleukin-1 alpha, IL-1 alpha

Product Description

Interleukin 1 alpha (IL-1alpha) also known as hematopoietin 1 is a cytokine of the interleukin 1 family that in humans is encoded by the IL1A gene. IL-1alpha is produced mainly by activated macrophages, as well as neutrophils, epithelial cells, and endothelial cells. It possesses metabolic, physiological, haematopoietic activities, and plays one of the central roles in the regulation of the immune responses. It binds to the interleukin-1 receptor. It is on the pathway that activates tumor necrosis factor-alpha.

Product Properties

• Concentration: < 0.1 EU/µg of the protein by LAL method.
• Molecular Weight: 17.99 kDa
• Tag: C-His
• NCBI: 16175
• UniProt: P01582
• Source: E. coli
• Purity: 95 % as determined by SDS-PAGE, 95 % as determined by HPLC.
• Form: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
• Sequence: SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
• Target: Il1a

Application Notes

• Application Dilute: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
• Application Notes: Cross-Reactivity: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water., ResearchArea: Other Recombinant Protein