Recombinant Mouse Interferon alpha/beta receptor 1/IFNAR1 Protein, Human

Artikelnummer: ABB-RP02612
Artikelname: Recombinant Mouse Interferon alpha/beta receptor 1/IFNAR1 Protein, Human
Artikelnummer: ABB-RP02612
Hersteller Artikelnummer: RP02612
Alternativnummer: ABB-RP02612-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Glu27-Thr429
Alternative Synonym: AVP, IFN-alpha/beta R1, IFN-alpha-REC, IFNAR, IFNAR1, IFN-aR1, IFNBR, IFNbR1, IFN-R-1, CRF2-1, IFRC
IFN-alpha / beta R1, also known as IFNAR1, belongs to the class II cytokine receptor family of proteins. Class II cytokine receptors form heterodimeric receptor complexes that mediate class II cytokine signals. Subunits of the different receptor complexes are shared and serve multiple functions.Functions in general as heterodimer with IFNAR2. Type I interferon binding activates the JAK-STAT signaling cascade, and triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and the IFNR alpha- and beta-subunits themselves.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 72.5 kDa
NCBI: 15975
UniProt: P33896
Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Sequenz: ENLKPPENIDVYIIDDNYTLKWSSHGESMGSVTFSAEYRTKDEAKWLKVPECQHTTTTKCEFSLLDTNVYIKTQFRVRAEEGNSTSSWNEVDPFIPFYTAHMSPPEVRLEAEDKAILVHISPPGQDGNMWALEKPSFSYTIRIWQKSSSDKKTINSTYYVEKIPELLPETTYCLEVKAIHPSLKKHSNYSTVQCISTTVANKMPVPGNLQVDAQGKSYVLKWDYIASADVLFRAQWLPGYSKSSSGSRSDKWKPI
Target-Kategorie: IFNAR1/IFN alpha/beta R1
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein