Recombinant Mouse Interferon alpha/beta receptor 1/IFNAR1 Protein, Human

Catalog Number: ABB-RP02612
Article Name: Recombinant Mouse Interferon alpha/beta receptor 1/IFNAR1 Protein, Human
Biozol Catalog Number: ABB-RP02612
Supplier Catalog Number: RP02612
Alternative Catalog Number: ABB-RP02612-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Glu27-Thr429
Alternative Names: AVP, IFN-alpha/beta R1, IFN-alpha-REC, IFNAR, IFNAR1, IFN-aR1, IFNBR, IFNbR1, IFN-R-1, CRF2-1, IFRC
IFN-alpha / beta R1, also known as IFNAR1, belongs to the class II cytokine receptor family of proteins. Class II cytokine receptors form heterodimeric receptor complexes that mediate class II cytokine signals. Subunits of the different receptor complexes are shared and serve multiple functions.Functions in general as heterodimer with IFNAR2. Type I interferon binding activates the JAK-STAT signaling cascade, and triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and the IFNR alpha- and beta-subunits themselves.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 72.5 kDa
NCBI: 15975
UniProt: P33896
Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Sequence: ENLKPPENIDVYIIDDNYTLKWSSHGESMGSVTFSAEYRTKDEAKWLKVPECQHTTTTKCEFSLLDTNVYIKTQFRVRAEEGNSTSSWNEVDPFIPFYTAHMSPPEVRLEAEDKAILVHISPPGQDGNMWALEKPSFSYTIRIWQKSSSDKKTINSTYYVEKIPELLPETTYCLEVKAIHPSLKKHSNYSTVQCISTTVANKMPVPGNLQVDAQGKSYVLKWDYIASADVLFRAQWLPGYSKSSSGSRSDKWKPI
Target: IFNAR1/IFN alpha/beta R1
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein