Recombinant Mouses LAMP5 Protein, Human

Produktübersicht

• Artikelname: Recombinant Mouses LAMP5 Protein, Human
• Artikelnummer: ABB-RP02615
• Hersteller Artikelnummer: RP02615
• Alternativnummer: ABB-RP02615-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Mouse
• Immunogen: Glu30-Glu235
• Alternative Synonym: BAD-LAMP, LAMP-5, BADLAMP, C20orf103, dJ1119D9.3, UNC-43

Produktbeschreibung

Lysosome-associated membrane protein 5 (LAMP5) is a mammalian ortholog of the Caenorhabditis elegans protein, UNC-46, which functions as a sorting factor to localize the vesicular GABA transporter UNC-47 to synaptic vesicles. LAMP5 deficiency led to a larger intensity-dependent increase of wave I, II and V peak amplitude of auditory brainstem response. LAMP5 plays a pivotal role in sensorimotor processing in the brainstem and spinal cord.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 50 kDa
• NCBI: 76161
• UniProt: Q9D387
• Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Sequenz: EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQAEISLTRGAEVKGHCGHNESELEVFWVDHAYTLRMLFVKESHNTSKGPEATWNLNKVHFVYDSSEKTHFKAPVKVNKYIASSHHLSALVTPAGMSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEQEQLEE
• Target-Kategorie: LAMP5

Anwendungsbeschreibung

• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein