Recombinant Mouses LAMP5 Protein, Human

Catalog Number: ABB-RP02615
Article Name: Recombinant Mouses LAMP5 Protein, Human
Biozol Catalog Number: ABB-RP02615
Supplier Catalog Number: RP02615
Alternative Catalog Number: ABB-RP02615-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Glu30-Glu235
Alternative Names: BAD-LAMP, LAMP-5, BADLAMP, C20orf103, dJ1119D9.3, UNC-43
Lysosome-associated membrane protein 5 (LAMP5) is a mammalian ortholog of the Caenorhabditis elegans protein, UNC-46, which functions as a sorting factor to localize the vesicular GABA transporter UNC-47 to synaptic vesicles. LAMP5 deficiency led to a larger intensity-dependent increase of wave I, II and V peak amplitude of auditory brainstem response. LAMP5 plays a pivotal role in sensorimotor processing in the brainstem and spinal cord.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 50 kDa
NCBI: 76161
UniProt: Q9D387
Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Sequence: EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQAEISLTRGAEVKGHCGHNESELEVFWVDHAYTLRMLFVKESHNTSKGPEATWNLNKVHFVYDSSEKTHFKAPVKVNKYIASSHHLSALVTPAGMSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEQEQLEE
Target: LAMP5
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein