Recombinant Human OSCAR Protein

Artikelnummer: ABB-RP02616
Artikelname: Recombinant Human OSCAR Protein
Artikelnummer: ABB-RP02616
Hersteller Artikelnummer: RP02616
Alternativnummer: ABB-RP02616-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Asp19-Ser229
Alternative Synonym: mOSCAR, OSCAR, PIGR3, PIgR-3, Poly-Ig receptor 3, MGC33613
Osteoclast-associated receptor (OSCAR) is a co-stimulatory receptor in osteoclastogenesis. Synovial tissues from active rheumatoid arthritis (RA) patients express higher levels of OSCAR compared with osteoarthritic and normal patients. OSCAR and tartrate-resistant acid phosphatase (TRAP) expression levels did not differ between the cartilage pannus junction (CPJ) and non-CPJ regions in active RA.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 49.8 kDa
NCBI: 126014
UniProt: Q8IYS5
Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Sequenz: DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASS
Target-Kategorie: OSCAR
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein