Recombinant Human OSCAR Protein

Catalog Number: ABB-RP02616
Article Name: Recombinant Human OSCAR Protein
Biozol Catalog Number: ABB-RP02616
Supplier Catalog Number: RP02616
Alternative Catalog Number: ABB-RP02616-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Asp19-Ser229
Alternative Names: mOSCAR, OSCAR, PIGR3, PIgR-3, Poly-Ig receptor 3, MGC33613
Osteoclast-associated receptor (OSCAR) is a co-stimulatory receptor in osteoclastogenesis. Synovial tissues from active rheumatoid arthritis (RA) patients express higher levels of OSCAR compared with osteoarthritic and normal patients. OSCAR and tartrate-resistant acid phosphatase (TRAP) expression levels did not differ between the cartilage pannus junction (CPJ) and non-CPJ regions in active RA.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 49.8 kDa
NCBI: 126014
UniProt: Q8IYS5
Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Sequence: DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASS
Target: OSCAR
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein