Recombinant Human TSLPR Protein

Artikelnummer: ABB-RP02623
Artikelname: Recombinant Human TSLPR Protein
Artikelnummer: ABB-RP02623
Hersteller Artikelnummer: RP02623
Alternativnummer: ABB-RP02623-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Gly25-Lys231
Alternative Synonym: TSLP receptor, TSLPR, CRL2, CRLF2Y, CRLF2, IL-XR, p2RY8/CRLF2 fusion, CRLF2
Thymic stromal lymphopoietin (TSLP) is an interleukin-7 (IL-7) like cytokine, which plays an important role in the regulation of immune responses to allergens. TSLP binds to a heterodimeric receptor complex composed of the IL-7 receptor alpha chain (IL-7Ralpha) and the TSLP receptor (TSLPR, also known as CRLF2).
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 50.8 kDa
NCBI: 64109
UniProt: Q9HC73
Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Sequenz: GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK
Target-Kategorie: TSLPR
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein