Recombinant Human IL-17Rc Protein

Artikelnummer: ABB-RP02624
Artikelname: Recombinant Human IL-17Rc Protein
Artikelnummer: ABB-RP02624
Hersteller Artikelnummer: RP02624
Alternativnummer: ABB-RP02624-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Leu21-Arg467
Alternative Synonym: IL-17 receptor C, IL-17RC, IL17Rhom, IL-17RL, ZcytoR14
IL-17RC (interleukin-17 receptor-like) gene codes for a transmembrane protein, the full length of which inhibits apoptosis in prostate cancer cells. IL-17RC gene transcribes over a dozen different splice variants of mRNA. IL-17RC protein isoforms are differentially expressed in prostatic cells and cancer tissues and may play a negative or positive role in the initiation and progression of prostate cancer.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 76.2 kDa
NCBI: 84818
UniProt: NP_703190.2
Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Sequenz: LERLVGPQDATHCSPGLSCRLWDSDILCLPGDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNHTQQLPDCRGLEVWNSIPSCWALPWLNVSADGDNVHLVLNVSEEQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQV
Target-Kategorie: IL-17Rc
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein