Recombinant Cynomolgus DNAM-1/CD226 Protein, Human

Produktübersicht

• Artikelname: Recombinant Cynomolgus DNAM-1/CD226 Protein, Human
• Artikelnummer: ABB-RP02629
• Hersteller Artikelnummer: RP02629
• Alternativnummer: ABB-RP02629-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Monkey
• Immunogen: Glu19-Phe252
• Alternative Synonym: CD226 molecule, CD226, DNAM1, PTA1, TLiSA1

Produktbeschreibung

DNAX accessory molecule-1 (DNAM-1), also known as CD226, is a 65 kDa type I transmembrane glycoprotein in the immunoglobulin superfamily.DNAM-1 mediates cellular adhesion to other cells bearing its ligands, CD112 and CD155, and cross-linking DNAM-1 with antibodies causes cellular activation. Furthermore, DNAM-1 can interact with PVR and PVRL2.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 27.7 kDa
• NCBI: 102117316
• UniProt: A0A2K5W1Z6
• Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Sequenz: EEVLWHTSVPFAENMSLECVYPSVGILTQVEWFKIGTEKDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDGFEAAVPPNSHIVSEPGKNITLTCQPQMTWPVQEVRWEKVQPHQIDLLTYCDLVHGRNFTSKFPRQIVSNCSHGSWSFIVVPDVTASDSGLYRCHLQASAGENETFVMRLTVAEGQTDNQYTRF
• Target-Kategorie: Cynomolgus DNAM-1/CD226

Anwendungsbeschreibung

• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein