Recombinant Cynomolgus DNAM-1/CD226 Protein, Human

Product Overview

• Article Name: Recombinant Cynomolgus DNAM-1/CD226 Protein, Human
• Biozol Catalog Number: ABB-RP02629
• Supplier Catalog Number: RP02629
• Alternative Catalog Number: ABB-RP02629-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Monkey
• Immunogen: Glu19-Phe252
• Alternative Names: CD226 molecule, CD226, DNAM1, PTA1, TLiSA1

Product Description

DNAX accessory molecule-1 (DNAM-1), also known as CD226, is a 65 kDa type I transmembrane glycoprotein in the immunoglobulin superfamily.DNAM-1 mediates cellular adhesion to other cells bearing its ligands, CD112 and CD155, and cross-linking DNAM-1 with antibodies causes cellular activation. Furthermore, DNAM-1 can interact with PVR and PVRL2.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 27.7 kDa
• NCBI: 102117316
• UniProt: A0A2K5W1Z6
• Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Sequence: EEVLWHTSVPFAENMSLECVYPSVGILTQVEWFKIGTEKDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDGFEAAVPPNSHIVSEPGKNITLTCQPQMTWPVQEVRWEKVQPHQIDLLTYCDLVHGRNFTSKFPRQIVSNCSHGSWSFIVVPDVTASDSGLYRCHLQASAGENETFVMRLTVAEGQTDNQYTRF
• Target: Cynomolgus DNAM-1/CD226

Application Notes

• Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein