Recombinant Cynomolgus LDLR Protein, Human

Produktübersicht

• Artikelname: Recombinant Cynomolgus LDLR Protein, Human
• Artikelnummer: ABB-RP02647
• Hersteller Artikelnummer: RP02647
• Alternativnummer: ABB-RP02647-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Monkey
• Immunogen: Ala22-Gly788
• Alternative Synonym: LDLR, FHC, LDL R, LDL receptor, LDLCQ2, FH

Produktbeschreibung

The low density lipoprotein receptor (LDLR) is the founding member of the LDL R family of widely expressed cell surface scavenger receptors. It is a cell-surface receptor that recognizes the apoprotein B100 which is embedded in the phospholipid outer layer of LDL particles.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 86 kDa
• NCBI: 102127361
• UniProt: XP_005588053.1
• Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Sequenz: AVGDRCERNEFQCEDGKCISYKWVCDGTAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGEVDCENGSDEQDCPPKTCSQDEFRCHDGKCIYRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQHCQGLEVPKRDRSPCSAFEFHCRSGECIHSGWRCDGGPDCKDKSDEENCPVATCRPDEFQCSDGTCIHGSRQCDREYDCKDMSDEVGCINVTLC
• Target-Kategorie: Cynomolgus LDLR

Anwendungsbeschreibung

• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein