Recombinant Cynomolgus LDLR Protein, Human

Catalog Number: ABB-RP02647
Article Name: Recombinant Cynomolgus LDLR Protein, Human
Biozol Catalog Number: ABB-RP02647
Supplier Catalog Number: RP02647
Alternative Catalog Number: ABB-RP02647-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Monkey
Immunogen: Ala22-Gly788
Alternative Names: LDLR, FHC, LDL R, LDL receptor, LDLCQ2, FH
The low density lipoprotein receptor (LDLR) is the founding member of the LDL R family of widely expressed cell surface scavenger receptors. It is a cell-surface receptor that recognizes the apoprotein B100 which is embedded in the phospholipid outer layer of LDL particles.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 86 kDa
NCBI: 102127361
UniProt: XP_005588053.1
Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Sequence: AVGDRCERNEFQCEDGKCISYKWVCDGTAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGEVDCENGSDEQDCPPKTCSQDEFRCHDGKCIYRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQHCQGLEVPKRDRSPCSAFEFHCRSGECIHSGWRCDGGPDCKDKSDEENCPVATCRPDEFQCSDGTCIHGSRQCDREYDCKDMSDEVGCINVTLC
Target: Cynomolgus LDLR
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein