Biotinylated Recombinant Cynomolgus CD3E&CD3D Protein (Primary Amine Labeling), Human

Produktübersicht

• Artikelname: Biotinylated Recombinant Cynomolgus CD3E&CD3D Protein (Primary Amine Labeling), Human
• Artikelnummer: ABB-RP02748B
• Hersteller Artikelnummer: RP02748B
• Alternativnummer: ABB-RP02748B-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Monkey
• Immunogen: Gln22-Asp117(CD3E)&Phe22-Ala105(CD3D)
• Alternative Synonym: CD3, CD3e, CD3E, CD3d, T3D, CD3D, CD3E&CD3D, CD3 delta&CD3 epsilon

Produktbeschreibung

T-cell surface glycoprotein CD3 epsilon & CD3 delta chain, also known as CD3E & CD3D , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 36.9 kDa (CD3E), 35.4 kDa (CD3D)
• UniProt: Q95LI5
• Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequenz: QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
• Target-Kategorie: CD3E&amp;CD3D

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein