Biotinylated Recombinant Cynomolgus CD3E&CD3D Protein (Primary Amine Labeling), Human

Product Overview

• Article Name: Biotinylated Recombinant Cynomolgus CD3E&CD3D Protein (Primary Amine Labeling), Human
• Biozol Catalog Number: ABB-RP02748B
• Supplier Catalog Number: RP02748B
• Alternative Catalog Number: ABB-RP02748B-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Monkey
• Immunogen: Gln22-Asp117(CD3E)&Phe22-Ala105(CD3D)
• Alternative Names: CD3, CD3e, CD3E, CD3d, T3D, CD3D, CD3E&CD3D, CD3 delta&CD3 epsilon

Product Description

T-cell surface glycoprotein CD3 epsilon & CD3 delta chain, also known as CD3E & CD3D , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 36.9 kDa (CD3E), 35.4 kDa (CD3D)
• UniProt: Q95LI5
• Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequence: QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
• Target: CD3E&amp;CD3D

Application Notes

• Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein