Recombinant Human CXCL14/BRAK Protein

Artikelnummer: ABB-RP02782
Artikelname: Recombinant Human CXCL14/BRAK Protein
Artikelnummer: ABB-RP02782
Hersteller Artikelnummer: RP02782
Alternativnummer: ABB-RP02782-20UG,ABB-RP02782-10UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Glu111
Alternative Synonym: KEC, KS1, BMAC, BRAK, NJAC, MIP2G, MIP-2g, SCYB14,CXCL14
CXCL14 is a CXC chemokine family that exhibits antimicrobial activity and contains an amphipathic cationic alpha-helical region in the C-terminus, a characteristic structure of antimicrobial peptides (AMPs). CXCL14 is involved in cell recruitment, migration, activation, and homing in liver diseases and have been shown to be upregulated during acute liver injury in animal models. The CXC chemokine ligand 14 (CXCL14) had been show highly expressed in tumor-associated stromal cells, promoting tumor cell growth, and invasion.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 13.91 kDa
NCBI: 9547
UniProt: O95715
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 0.5 M NaCl, 0.5 M Arginine, pH7.4.
Sequenz: MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Target-Kategorie: CXCL14/BRAK
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 0.5 M NaCl, 0.5 M Arginine, pH7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors