Recombinant Human CXCL14/BRAK Protein

Catalog Number: ABB-RP02782
Article Name: Recombinant Human CXCL14/BRAK Protein
Biozol Catalog Number: ABB-RP02782
Supplier Catalog Number: RP02782
Alternative Catalog Number: ABB-RP02782-20UG,ABB-RP02782-10UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Glu111
Alternative Names: KEC, KS1, BMAC, BRAK, NJAC, MIP2G, MIP-2g, SCYB14,CXCL14
CXCL14 is a CXC chemokine family that exhibits antimicrobial activity and contains an amphipathic cationic alpha-helical region in the C-terminus, a characteristic structure of antimicrobial peptides (AMPs). CXCL14 is involved in cell recruitment, migration, activation, and homing in liver diseases and have been shown to be upregulated during acute liver injury in animal models. The CXC chemokine ligand 14 (CXCL14) had been show highly expressed in tumor-associated stromal cells, promoting tumor cell growth, and invasion.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 13.91 kDa
NCBI: 9547
UniProt: O95715
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 0.5 M NaCl, 0.5 M Arginine, pH7.4.
Sequence: MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Target: CXCL14/BRAK
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 0.5 M NaCl, 0.5 M Arginine, pH7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors