Recombinant Human Lactate Dehydrogenase A/LDHA Protein, E. coli

Artikelnummer: ABB-RP02791LQ
Artikelname: Recombinant Human Lactate Dehydrogenase A/LDHA Protein, E. coli
Artikelnummer: ABB-RP02791LQ
Hersteller Artikelnummer: RP02791LQ
Alternativnummer: ABB-RP02791LQ-10UG, ABB-RP02791LQ-100UG, ABB-RP02791LQ-20UG, ABB-RP02791LQ-50UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Phe332
Alternative Synonym: LDHM, GSD11, PIG19, HEL-S-133P, LDHA
L-Lactate Dehydrogenase A Chain (LDHA) is an enzyme that catalyzes the conversion of L-lactate and NAD+ to pyruvate and NADH in the final step of anaerobic glycolysis. LDHA contains an N-terminal coenzyme binding region, a central catalytic site, and at least nine utilized Lys acetylation and two Tyr phosphorylation sites. LDHA belongs to the lactate dehydrogenase family, expressed predominantly in muscle tissue. LDHA mutations have been linked to exertional myoglobinuria.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 37.53 kDa
NCBI: 3939
UniProt: P00338
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Supplied as a 0.22 µm filtered solution in 20mM Tris, 250mM NaCl,10% Glycerol, pH8.0.
Sequenz: MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLS
Target-Kategorie: Lactate Dehydrogenase A/LDHA
Application Verdünnung: Supplied as a 0.22 µm filtered solution in 20mM Tris, 250mM NaCl,10% Glycerol, pH8.0.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein