Recombinant Human Lactate Dehydrogenase A/LDHA Protein, E. coli

Catalog Number: ABB-RP02791LQ
Article Name: Recombinant Human Lactate Dehydrogenase A/LDHA Protein, E. coli
Biozol Catalog Number: ABB-RP02791LQ
Supplier Catalog Number: RP02791LQ
Alternative Catalog Number: ABB-RP02791LQ-10UG, ABB-RP02791LQ-100UG, ABB-RP02791LQ-20UG, ABB-RP02791LQ-50UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Phe332
Alternative Names: LDHM, GSD11, PIG19, HEL-S-133P, LDHA
L-Lactate Dehydrogenase A Chain (LDHA) is an enzyme that catalyzes the conversion of L-lactate and NAD+ to pyruvate and NADH in the final step of anaerobic glycolysis. LDHA contains an N-terminal coenzyme binding region, a central catalytic site, and at least nine utilized Lys acetylation and two Tyr phosphorylation sites. LDHA belongs to the lactate dehydrogenase family, expressed predominantly in muscle tissue. LDHA mutations have been linked to exertional myoglobinuria.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 37.53 kDa
NCBI: 3939
UniProt: P00338
Purity: 95 % as determined by SDS-PAGE.
Form: Supplied as a 0.22 µm filtered solution in 20mM Tris, 250mM NaCl,10% Glycerol, pH8.0.
Sequence: MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLS
Target: Lactate Dehydrogenase A/LDHA
Application Dilute: Supplied as a 0.22 µm filtered solution in 20mM Tris, 250mM NaCl,10% Glycerol, pH8.0.
Application Notes: ResearchArea: Other Recombinant Protein