Recombinant Human Apolipoprotein B/APOB Protein, E. coli

Produktübersicht

• Artikelname: Recombinant Human Apolipoprotein B/APOB Protein, E. coli
• Artikelnummer: ABB-RP02796LQ
• Hersteller Artikelnummer: RP02796LQ
• Alternativnummer: ABB-RP02796LQ-10UG,ABB-RP02796LQ-50UG
• Hersteller: ABclonal
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Glu28-Ser127
• Alternative Synonym: ApolipoproteinB-100, APOB

Produktbeschreibung

Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 13.5 kDa
• Tag: N-His
• NCBI: 338
• UniProt: P04114
• Quelle: E. coli
• Reinheit: 90 % as determined by SDS-PAGE.
• Formulierung: Supplied as a 0.22 µm filtered solution in 20mM Tris-HCl, 250mMNacl, 10% Glycerol, 2mMEDTA, pH8.0.
• Sequenz: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
• Target-Kategorie: Apolipoprotein B/APOB

Anwendungsbeschreibung

• Application Verdünnung: Supplied as a 0.22 µm filtered solution in 20mM Tris-HCl, 250mMNacl, 10% Glycerol, 2mMEDTA, pH8.0.
• Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein