Recombinant Human Apolipoprotein B/APOB Protein, E. coli

Artikelnummer: ABB-RP02796LQ
Artikelname: Recombinant Human Apolipoprotein B/APOB Protein, E. coli
Artikelnummer: ABB-RP02796LQ
Hersteller Artikelnummer: RP02796LQ
Alternativnummer: ABB-RP02796LQ-10UG,ABB-RP02796LQ-50UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Glu28-Ser127
Alternative Synonym: ApolipoproteinB-100, APOB
Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 13.5 kDa
Tag: N-His
NCBI: 338
UniProt: P04114
Quelle: E. coli
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Supplied as a 0.22 µm filtered solution in 20mM Tris-HCl, 250mMNacl, 10% Glycerol, 2mMEDTA, pH8.0.
Sequenz: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Target-Kategorie: Apolipoprotein B/APOB
Application Verdünnung: Supplied as a 0.22 µm filtered solution in 20mM Tris-HCl, 250mMNacl, 10% Glycerol, 2mMEDTA, pH8.0.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein
Recombinant Human Apolipoprotein B/APOB Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.