Recombinant Human Apolipoprotein B/APOB Protein, E. coli

Catalog Number: ABB-RP02796LQ
Article Name: Recombinant Human Apolipoprotein B/APOB Protein, E. coli
Biozol Catalog Number: ABB-RP02796LQ
Supplier Catalog Number: RP02796LQ
Alternative Catalog Number: ABB-RP02796LQ-10UG,ABB-RP02796LQ-50UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Glu28-Ser127
Alternative Names: ApolipoproteinB-100, APOB
Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 13.5 kDa
Tag: N-His
NCBI: 338
UniProt: P04114
Source: E. coli
Purity: 90 % as determined by SDS-PAGE.
Form: Supplied as a 0.22 µm filtered solution in 20mM Tris-HCl, 250mMNacl, 10% Glycerol, 2mMEDTA, pH8.0.
Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Target: Apolipoprotein B/APOB
Application Dilute: Supplied as a 0.22 µm filtered solution in 20mM Tris-HCl, 250mMNacl, 10% Glycerol, 2mMEDTA, pH8.0.
Application Notes: ResearchArea: Other Recombinant Protein
Recombinant Human Apolipoprotein B/APOB Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.