Recombinant Human Apolipoprotein B/APOB Protein, E. coli

Product Overview

• Article Name: Recombinant Human Apolipoprotein B/APOB Protein, E. coli
• Biozol Catalog Number: ABB-RP02796LQ
• Supplier Catalog Number: RP02796LQ
• Alternative Catalog Number: ABB-RP02796LQ-10UG,ABB-RP02796LQ-50UG
• Manufacturer: ABclonal
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Glu28-Ser127
• Alternative Names: ApolipoproteinB-100, APOB

Product Description

Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 13.5 kDa
• Tag: N-His
• NCBI: 338
• UniProt: P04114
• Source: E. coli
• Purity: 90 % as determined by SDS-PAGE.
• Form: Supplied as a 0.22 µm filtered solution in 20mM Tris-HCl, 250mMNacl, 10% Glycerol, 2mMEDTA, pH8.0.
• Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
• Target: Apolipoprotein B/APOB

Application Notes

• Application Dilute: Supplied as a 0.22 µm filtered solution in 20mM Tris-HCl, 250mMNacl, 10% Glycerol, 2mMEDTA, pH8.0.
• Application Notes: ResearchArea: Other Recombinant Protein