Recombinant Human Creatine Kinase MM/CKMM Protein

Produktübersicht

• Artikelname: Recombinant Human Creatine Kinase MM/CKMM Protein
• Artikelnummer: ABB-RP02817LQ
• Hersteller Artikelnummer: RP02817LQ
• Alternativnummer: ABB-RP02817LQ-50UG,ABB-RP02817LQ-10UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Met1-Lys381
• Alternative Synonym: Creatine kinase M-type, Creatine kinase M chain, M-CK, CKM, CKMM

Produktbeschreibung

Creatine kinase M-type is also known as Creatine kinase M chain,M-CK. It is a protein that in humans is encoded by the CKM gene. It belongs to the ATP:guanido phosphotransferase family,containing 1 phosphagen kinase C-terminal domain and 1 phosphagen kinase N-terminal domain. Creatine kinase M-type can reversibly catalyzes the transfer of phosphate between ATP and various phosphogens. It plays a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 44.1 kDa
• Tag: C-His
• NCBI: 1158
• UniProt: P06732
• Quelle: HEK293 cells
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Supplied as a 0.22 µm filtered solution in 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5.
• Sequenz: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCV
• Target-Kategorie: Creatine Kinase MM/CKMM

Anwendungsbeschreibung

• Application Verdünnung: Supplied as a 0.22 µm filtered solution in 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5.
• Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein