Recombinant Human Creatine Kinase MM/CKMM Protein

Catalog Number: ABB-RP02817LQ
Article Name: Recombinant Human Creatine Kinase MM/CKMM Protein
Biozol Catalog Number: ABB-RP02817LQ
Supplier Catalog Number: RP02817LQ
Alternative Catalog Number: ABB-RP02817LQ-10UG,ABB-RP02817LQ-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Lys381
Alternative Names: Creatine kinase M-type, Creatine kinase M chain, M-CK, CKM, CKMM
Creatine kinase M-type is also known as Creatine kinase M chain,M-CK. It is a protein that in humans is encoded by the CKM gene. It belongs to the ATP:guanido phosphotransferase family,containing 1 phosphagen kinase C-terminal domain and 1 phosphagen kinase N-terminal domain. Creatine kinase M-type can reversibly catalyzes the transfer of phosphate between ATP and various phosphogens. It plays a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 44.1 kDa
Tag: C-His
NCBI: 1158
UniProt: P06732
Source: HEK293 cells
Purity: 95 % as determined by SDS-PAGE.
Form: Supplied as a 0.22 µm filtered solution in 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5.
Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCV
Target: Creatine Kinase MM/CKMM
Application Dilute: Supplied as a 0.22 µm filtered solution in 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5.
Application Notes: ResearchArea: Other Recombinant Protein
Recombinant Human Creatine Kinase MM/CKMM Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.