Recombinant Human Creatine Kinase MM/CKMM Protein

Product Overview

• Article Name: Recombinant Human Creatine Kinase MM/CKMM Protein
• Biozol Catalog Number: ABB-RP02817LQ
• Supplier Catalog Number: RP02817LQ
• Alternative Catalog Number: ABB-RP02817LQ-50UG,ABB-RP02817LQ-10UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Met1-Lys381
• Alternative Names: Creatine kinase M-type, Creatine kinase M chain, M-CK, CKM, CKMM

Product Description

Creatine kinase M-type is also known as Creatine kinase M chain,M-CK. It is a protein that in humans is encoded by the CKM gene. It belongs to the ATP:guanido phosphotransferase family,containing 1 phosphagen kinase C-terminal domain and 1 phosphagen kinase N-terminal domain. Creatine kinase M-type can reversibly catalyzes the transfer of phosphate between ATP and various phosphogens. It plays a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 44.1 kDa
• Tag: C-His
• NCBI: 1158
• UniProt: P06732
• Source: HEK293 cells
• Purity: 95 % as determined by SDS-PAGE.
• Form: Supplied as a 0.22 µm filtered solution in 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5.
• Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCV
• Target: Creatine Kinase MM/CKMM

Application Notes

• Application Dilute: Supplied as a 0.22 µm filtered solution in 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5.
• Application Notes: ResearchArea: Other Recombinant Protein