Recombinant Human TUBB4A Protein, E. coli

Artikelnummer: ABB-RP02833
Artikelname: Recombinant Human TUBB4A Protein, E. coli
Artikelnummer: ABB-RP02833
Hersteller Artikelnummer: RP02833
Alternativnummer: ABB-RP02833-50UG, ABB-RP02833-10UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Ala444
Alternative Synonym: Tubulin Beta-4A Chain, Tubulin 5 Beta, Tubulin Beta-4 Chain, TUBB4A, TUBB4, TUBB5
Tubulin Beta-4A Chain (TUBB4A) is a cytoplasmic peptide containing 444 amino acids. TUBB4A is a member of the Tubulin family. Tubulin is the major constituent of microtubules. Tubulin is a dimer composed of one alpha and one beta tubulin molecule, there are many forms of beta tubulins, Beta II and Beta IV Tubulin are ubiquitously expressed. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 51.7 kDa
NCBI: 10382
UniProt: P04350
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 20mM Tris-HCl, 50mM NaCl, 2M Urea, pH8.0.
Sequenz: MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAV
Target-Kategorie: TUBB4A
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 20mM Tris-HCl, 50mM NaCl, 2M Urea, pH8.0.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein