Recombinant Human TUBB4A Protein, E. coli

Catalog Number: ABB-RP02833
Article Name: Recombinant Human TUBB4A Protein, E. coli
Biozol Catalog Number: ABB-RP02833
Supplier Catalog Number: RP02833
Alternative Catalog Number: ABB-RP02833-50UG, ABB-RP02833-10UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Ala444
Alternative Names: Tubulin Beta-4A Chain, Tubulin 5 Beta, Tubulin Beta-4 Chain, TUBB4A, TUBB4, TUBB5
Tubulin Beta-4A Chain (TUBB4A) is a cytoplasmic peptide containing 444 amino acids. TUBB4A is a member of the Tubulin family. Tubulin is the major constituent of microtubules. Tubulin is a dimer composed of one alpha and one beta tubulin molecule, there are many forms of beta tubulins, Beta II and Beta IV Tubulin are ubiquitously expressed. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 51.7 kDa
NCBI: 10382
UniProt: P04350
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 20mM Tris-HCl, 50mM NaCl, 2M Urea, pH8.0.
Sequence: MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAV
Target: TUBB4A
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 20mM Tris-HCl, 50mM NaCl, 2M Urea, pH8.0.
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein