Recombinant Human GPX4 Protein, E. coli

Produktübersicht

• Artikelname: Recombinant Human GPX4 Protein, E. coli
• Artikelnummer: ABB-RP02834
• Hersteller Artikelnummer: RP02834
• Alternativnummer: ABB-RP02834-100UG
• Hersteller: ABclonal
• Wirt: E. coli
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Gly26-Phe197,U73C
• Alternative Synonym: MCSP, SMDS, GPx-4, PHGPx, snGPx, GSHPx-4, snPHGPx,GPX4

Produktbeschreibung

Recombinant Human GPX4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly26-Phe197,U73C) of human GPX4 (Accession NP_002076.2) fused with a 6*His tag at the N-terminus.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 20.59 kDa
• Tag: N-His
• NCBI: 2879
• UniProt: P36969
• Quelle: E. coli
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of 150MM NaCl, 50mM Tris, pH 8.0.
• Sequenz: GTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
• Target-Kategorie: GPX4

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 150MM NaCl, 50mM Tris, pH 8.0.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein