Recombinant Human GPX4 Protein, E. coli

Product Overview

• Article Name: Recombinant Human GPX4 Protein, E. coli
• Biozol Catalog Number: ABB-RP02834
• Supplier Catalog Number: RP02834
• Alternative Catalog Number: ABB-RP02834-100UG
• Manufacturer: ABclonal
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Gly26-Phe197,U73C
• Alternative Names: MCSP, SMDS, GPx-4, PHGPx, snGPx, GSHPx-4, snPHGPx,GPX4

Product Description

Recombinant Human GPX4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly26-Phe197,U73C) of human GPX4 (Accession NP_002076.2) fused with a 6*His tag at the N-terminus.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 20.59 kDa
• Tag: N-His
• NCBI: 2879
• UniProt: P36969
• Source: E. coli
• Purity: 95 % as determined by SDS-PAGE.
• Form: Lyophilized from a 0.22 µm filtered solution of 150MM NaCl, 50mM Tris, pH 8.0.
• Sequence: GTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
• Target: GPX4

Application Notes

• Application Dilute: Lyophilized from a 0.22 µm filtered solution of 150MM NaCl, 50mM Tris, pH 8.0.
• Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein

Images

Recombinant Human GPX4 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.