Recombinant Mouse Alkaline phosphatase (Intestinal type)/ALPI Protein, Human

Artikelnummer: ABB-RP02846
Artikelname: Recombinant Mouse Alkaline phosphatase (Intestinal type)/ALPI Protein, Human
Artikelnummer: ABB-RP02846
Hersteller Artikelnummer: RP02846
Alternativnummer: ABB-RP02846-100UG,ABB-RP02846-50UG,ABB-RP02846-20UG,ABB-RP02846-10UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Ile21-Gly501
Alternative Synonym: Alkaline phosphatase,Alpi
Alkaline phosphatase can be considered our favorite enzyme for reasons apparent to those who diagnose and treat metabolic bone diseases or who study skeletal biology. Few might know, however, that alkaline phosphatase likely represents the most frequently assayed enzyme in all of medicine. Elevated activity in the circulation is universally recognized as a marker for skeletal or hepatobiliary disease.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 52.85 kDa
Tag: C-His
NCBI: 76768
UniProt: F8VPQ6
Quelle: HEK293 cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: IIPAEEENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETPLAMDLFPYMALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCNTTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQDGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTWLSKHQGARYVWNRSELIQ
Target-Kategorie: ALPI
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein