Recombinant Mouse Alkaline phosphatase (Intestinal type)/ALPI Protein, Human

Catalog Number: ABB-RP02846
Article Name: Recombinant Mouse Alkaline phosphatase (Intestinal type)/ALPI Protein, Human
Biozol Catalog Number: ABB-RP02846
Supplier Catalog Number: RP02846
Alternative Catalog Number: ABB-RP02846-100UG,ABB-RP02846-50UG,ABB-RP02846-20UG,ABB-RP02846-10UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Ile21-Gly501
Alternative Names: Alkaline phosphatase,Alpi
Alkaline phosphatase can be considered our favorite enzyme for reasons apparent to those who diagnose and treat metabolic bone diseases or who study skeletal biology. Few might know, however, that alkaline phosphatase likely represents the most frequently assayed enzyme in all of medicine. Elevated activity in the circulation is universally recognized as a marker for skeletal or hepatobiliary disease.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 52.85 kDa
Tag: C-His
NCBI: 76768
UniProt: F8VPQ6
Source: HEK293 cells
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: IIPAEEENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETPLAMDLFPYMALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCNTTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQDGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTWLSKHQGARYVWNRSELIQ
Target: ALPI
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein