Recombinant Human CD7 Protein

Produktübersicht

• Artikelname: Recombinant Human CD7 Protein
• Artikelnummer: ABB-RP02864
• Hersteller Artikelnummer: RP02864
• Alternativnummer: ABB-RP02864-50UG, ABB-RP02864-10UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Ala26-Pro180
• Alternative Synonym: CD7 molecule, LEU-9, Tp40, TP41, GP40

Produktbeschreibung

CD7, also known as Leu-9, is an approximately 40 kDa glycosylated and palmitoylated transmembrane protein in the immunoglobulin superfamily.CD7 is expressed on T cells, NK cells , myeloid progenitor cells, and CD19 B progenitor cells. Among CD8 T cells, the CD7-bright population preferentially contains na?ve and memory cells, while more weak expressors are primarily effector cells.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 42.39 kDa
• NCBI: 924
• UniProt: P09564
• Reinheit: 95 % as determined by SDS-PAGE, 95 % as determined by HPLC.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequenz: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
• Target-Kategorie: CD7

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Bio-Markers & CD Antigens