Recombinant Human CD7 Protein

Product Overview

• Article Name: Recombinant Human CD7 Protein
• Biozol Catalog Number: ABB-RP02864
• Supplier Catalog Number: RP02864
• Alternative Catalog Number: ABB-RP02864-50UG, ABB-RP02864-10UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Ala26-Pro180
• Alternative Names: CD7 molecule, LEU-9, Tp40, TP41, GP40

Product Description

CD7, also known as Leu-9, is an approximately 40 kDa glycosylated and palmitoylated transmembrane protein in the immunoglobulin superfamily.CD7 is expressed on T cells, NK cells , myeloid progenitor cells, and CD19 B progenitor cells. Among CD8 T cells, the CD7-bright population preferentially contains na?ve and memory cells, while more weak expressors are primarily effector cells.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 42.39 kDa
• NCBI: 924
• UniProt: P09564
• Purity: 95 % as determined by SDS-PAGE, 95 % as determined by HPLC.
• Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
• Target: CD7

Application Notes

• Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Bio-Markers & CD Antigens