Recombinant Human Angiopoietin-like 3/ANGPTL3(17-460) Protein

Artikelnummer: ABB-RP02866
Artikelname: Recombinant Human Angiopoietin-like 3/ANGPTL3(17-460) Protein
Artikelnummer: ABB-RP02866
Hersteller Artikelnummer: RP02866
Alternativnummer: ABB-RP02866-10UG,ABB-RP02866-100UG,ABB-RP02866-20UG,ABB-RP02866-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ser17-Glu460
Alternative Synonym: ANG-5, ANGPT5, ANL3, FHBL2,ANGPTL3,ANGPT5,ANL3,FHBL2,ANGPTL3
Angiopoietin-like protein 3 (ANGPTL3) also known as Angiopoietin-related protein 3, Angiopoietin-5 (ANG-5) is a secreted glycoprotein that is structurally related to the angiopoietins.Human ANGPTL3 contains an N-terminal coiled coil domain and a C-terminal fibrinogen-like domain. The fibrinogen C-terminal domain is sufficient to mediate endothelial cell adhesion. ANGPTL3 is principally expressed in the liver and can exert activities related to both angiogenesis and lipid metabolism.ANGPTL3 directly inhibits lipoprotein lipase (LPL) and endothelial lipase (EL), enzymes responsible for hydrolyzing circulating triglycerides and HDL phospholipids.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 52.65 kDa
Tag: C-His
NCBI: 27329
UniProt: Q9Y5C1
Quelle: HEK293 cells
Reinheit: 90% as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, 0.05% CHAPS, pH7.4.
Sequenz: SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFH
Target-Kategorie: Angiopoietin-like 3/ANGPTL3
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, 0.05% CHAPS, pH7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors