Recombinant Human Angiopoietin-like 3/ANGPTL3(17-460) Protein

Catalog Number: ABB-RP02866
Article Name: Recombinant Human Angiopoietin-like 3/ANGPTL3(17-460) Protein
Biozol Catalog Number: ABB-RP02866
Supplier Catalog Number: RP02866
Alternative Catalog Number: ABB-RP02866-10UG,ABB-RP02866-100UG,ABB-RP02866-20UG,ABB-RP02866-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ser17-Glu460
Alternative Names: ANG-5, ANGPT5, ANL3, FHBL2,ANGPTL3,ANGPT5,ANL3,FHBL2,ANGPTL3
Angiopoietin-like protein 3 (ANGPTL3) also known as Angiopoietin-related protein 3, Angiopoietin-5 (ANG-5) is a secreted glycoprotein that is structurally related to the angiopoietins.Human ANGPTL3 contains an N-terminal coiled coil domain and a C-terminal fibrinogen-like domain. The fibrinogen C-terminal domain is sufficient to mediate endothelial cell adhesion. ANGPTL3 is principally expressed in the liver and can exert activities related to both angiogenesis and lipid metabolism.ANGPTL3 directly inhibits lipoprotein lipase (LPL) and endothelial lipase (EL), enzymes responsible for hydrolyzing circulating triglycerides and HDL phospholipids.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 52.65 kDa
Tag: C-His
NCBI: 27329
UniProt: Q9Y5C1
Source: HEK293 cells
Purity: 90% as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, 0.05% CHAPS, pH7.4.
Sequence: SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFH
Target: Angiopoietin-like 3/ANGPTL3
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, 0.05% CHAPS, pH7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors