Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein

Produktübersicht

• Artikelname: Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein
• Artikelnummer: ABB-RP02873
• Hersteller Artikelnummer: RP02873
• Alternativnummer: ABB-RP02873-50UG, ABB-RP02873-10UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Ser21-Gln165
• Alternative Synonym: CGB3,CGB,CGB5,CGB7,CGB8,hCGB

Produktbeschreibung

Choriogonadotropin subunit beta is also known as CG-beta, Chorionic gonadotrophin chain beta. It is a protein that in humans is encoded by the CGB gene. It belongs to the glycoprotein hormones subunit beta family. Choriogonadotropin subunit beta can stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 16.7 kDa
• NCBI: 1082
• UniProt: P0DN86
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
• Sequenz: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
• Target-Kategorie: CG-beta/CGB3

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein