Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein

Product Overview

• Article Name: Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein
• Biozol Catalog Number: ABB-RP02873
• Supplier Catalog Number: RP02873
• Alternative Catalog Number: ABB-RP02873-50UG, ABB-RP02873-10UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Ser21-Gln165
• Alternative Names: CGB3,CGB,CGB5,CGB7,CGB8,hCGB

Product Description

Choriogonadotropin subunit beta is also known as CG-beta, Chorionic gonadotrophin chain beta. It is a protein that in humans is encoded by the CGB gene. It belongs to the glycoprotein hormones subunit beta family. Choriogonadotropin subunit beta can stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 16.7 kDa
• NCBI: 1082
• UniProt: P0DN86
• Purity: 95 % as determined by SDS-PAGE.
• Form: Lyophilized from a 0.22 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
• Sequence: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
• Target: CG-beta/CGB3

Application Notes

• Application Dilute: Lyophilized from a 0.22 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
• Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein