Recombinant Human PMKase/PMVK Protein, E. coli

Artikelnummer: ABB-RP02879LQ
Artikelname: Recombinant Human PMKase/PMVK Protein, E. coli
Artikelnummer: ABB-RP02879LQ
Hersteller Artikelnummer: RP02879LQ
Alternativnummer: ABB-RP02879LQ-50UG,ABB-RP02879LQ-10UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Leu192
Alternative Synonym: PMVK,HUMPMKI,PMK,PMKA,PMKASE,POROK1
Phosphomevalonate kinase (PMVK) is a cytosolic enzyme. PMVK can be highly expressed in the heart,skeletal muscle, liver, pancreas, and kidney, it is expressed at lower levels in the brain, lung, and placenta. Induced by sterol, PMVK takes part in isopentenyl diphosphate biosynthesis through the mevalonate pathway. PMVK catalyzes the conversion of mevalonate 5-phosphate into mevalonate 5-diphosphate in the fifth reaction of the cholesterol biosynthetic pathway.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 24.2 kDa
Tag: N-His
NCBI: 10654
UniProt: Q15126
Quelle: E. coli
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 7.5.
Sequenz: MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
Target-Kategorie: PMKase/PMVK
Application Verdünnung: Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 7.5.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein
Recombinant Human PMKase/PMVK Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.