Recombinant Human PMKase/PMVK Protein, E. coli

Product Overview

• Article Name: Recombinant Human PMKase/PMVK Protein, E. coli
• Biozol Catalog Number: ABB-RP02879LQ
• Supplier Catalog Number: RP02879LQ
• Alternative Catalog Number: ABB-RP02879LQ-10UG,ABB-RP02879LQ-50UG
• Manufacturer: ABclonal
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Met1-Leu192
• Alternative Names: PMVK,HUMPMKI,PMK,PMKA,PMKASE,POROK1

Product Description

Phosphomevalonate kinase (PMVK) is a cytosolic enzyme. PMVK can be highly expressed in the heart,skeletal muscle, liver, pancreas, and kidney, it is expressed at lower levels in the brain, lung, and placenta. Induced by sterol, PMVK takes part in isopentenyl diphosphate biosynthesis through the mevalonate pathway. PMVK catalyzes the conversion of mevalonate 5-phosphate into mevalonate 5-diphosphate in the fifth reaction of the cholesterol biosynthetic pathway.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 24.2 kDa
• Tag: N-His
• NCBI: 10654
• UniProt: Q15126
• Source: E. coli
• Purity: 95 % as determined by SDS-PAGE.
• Form: Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 7.5.
• Sequence: MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
• Target: PMKase/PMVK

Application Notes

• Application Dilute: Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 7.5.
• Application Notes: ResearchArea: Other Recombinant Protein