Recombinant Human Aldehyde reductase/AKR1B1 Protein, E. coli

Artikelnummer: ABB-RP02938
Artikelname: Recombinant Human Aldehyde reductase/AKR1B1 Protein, E. coli
Artikelnummer: ABB-RP02938
Hersteller Artikelnummer: RP02938
Alternativnummer: ABB-RP02938-100UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Phe316
Alternative Synonym: AKR1B1, ADR, ALDR1, ALR2, AR, aldose reductase,ADR,ALDR1,ALR2,AR
Aldose reductase (AKR1B1) belongs to the aldo/keto reductase superfamily. AKR1B1 is a NADPH-dependent aldo-keto reductase best known as the rate-limiting enzyme of the polyol pathway. Expression of AKR1B1 was the highest in lens and retina. It is the first enzyme in the polyol pathway through which glucose is converted to sorbitol which is important for the function of various organs in the body, and has been implicated in the etiology of diabetic complications. AKR1B1 is quite abundant in the collecting tubule cells and thought to provide protection against hypertonic environment. Some human tissues contain AKR1B1 as well as AKR1B10, a closely related member of the aldo-keto reductase superfamily.
Konzentration: Please contact us for more information.
Molekulargewicht: 37.9 kDa
Tag: N-His
NCBI: 231
UniProt: P15121
Quelle: E. coli
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, 20% glycerol, pH 7.5.
Sequenz: MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQ
Target-Kategorie: Aldehyde reductase/AKR1B1
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, 20% glycerol, pH 7.5.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Human Aldehyde reductase/AKR1B1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.